Bruceantinol A

CAS No. 948038-36-6

Bruceantinol A( —— )

Catalog No. M31670 CAS No. 948038-36-6

Bruceantinol A is a natural product from Brucea javanica.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 389 In Stock
50MG Get Quote In Stock
100MG Get Quote In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Bruceantinol A
  • Note
    Research use only, not for human use.
  • Brief Description
    Bruceantinol A is a natural product from Brucea javanica.
  • Description
    Bruceantinol A is a natural product from Brucea javanica.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    948038-36-6
  • Formula Weight
    592.59
  • Molecular Formula
    C29H36O13
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    ——
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • Baccatin III

    Baccatin III is an isolate of the Pacific yew tree (Taxus brevifolia) and related species. Baccatin III is a precursor to the anti-Y drug paclitaxel (Taxol).

  • Peonidin-3-O-[6-O-(E...

    Peonidin-3-O-[6-O-(E)-Caffeoyl-2-O-{6-O-(E)-Ferulyl-β-D-glucoside}-β-D-glucoside]-5-O-β-D-glucoside