Erigeside I

CAS No. 224824-74-2

Erigeside I( —— )

Catalog No. M31546 CAS No. 224824-74-2

Erigeside I is a radical scavenger.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 1053 In Stock
50MG Get Quote In Stock
100MG Get Quote In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Erigeside I
  • Note
    Research use only, not for human use.
  • Brief Description
    Erigeside I is a radical scavenger.
  • Description
    Erigeside I is a radical scavenger.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    224824-74-2
  • Formula Weight
    436.36
  • Molecular Formula
    C20H20O11
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    ——
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • Kinetensin

    Kinetensin is a neurotensin-like peptide.

  • ETHYL 4-AMINO-2-(MET...

    ETHYL 4-AMINO-2-(METHYLTHIO)PYRIMIDINE-5-CARBOXYLATE used for preparation of pyrimidopyrimidines as protein kinase inhibitors.

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.