Marmesin b

CAS No. 13710-70-8

Marmesin b( —— )

Catalog No. M31316 CAS No. 13710-70-8

Marmesin is a novel angiogenesis inhibitor.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 61 In Stock
10MG 92 In Stock
25MG 187 In Stock
50MG 299 In Stock
100MG Get Quote In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Marmesin b
  • Note
    Research use only, not for human use.
  • Brief Description
    Marmesin is a novel angiogenesis inhibitor.
  • Description
    Marmesin is a novel angiogenesis inhibitor.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    13710-70-8
  • Formula Weight
    246.3
  • Molecular Formula
    C14H14O4
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    ——
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

  • Trithiozine

    Trithiozine exhibits antisecretory and antiulcer capacity. Trithiozine can be used for research on the treatment of peptic ulcer disease and hypersecretory disorders.

  • Bifenazate

    Bifenazate is a positive allosteric modulator of GABA receptor. Bifenazate is an acaricide that controls 100% of mites at a concentration of 25 ppm.