Home - Products - Others - Other Targets - Pelargonidin-3,5-O-diglucoside chloride

Pelargonidin-3,5-O-diglucoside chloride

CAS No. 17334-58-6

Pelargonidin-3,5-O-diglucoside chloride( —— )

Catalog No. M31224 CAS No. 17334-58-6

Pelargonidin-3,5-O-diglucoside chloride has antioxidant activity.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 639 In Stock
50MG Get Quote In Stock
100MG Get Quote In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Pelargonidin-3,5-O-diglucoside chloride
  • Note
    Research use only, not for human use.
  • Brief Description
    Pelargonidin-3,5-O-diglucoside chloride has antioxidant activity.
  • Description
    Pelargonidin-3,5-O-diglucoside chloride has antioxidant activity.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    17334-58-6
  • Formula Weight
    631
  • Molecular Formula
    C27H31O15Cl
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    ——
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • 3,6-O-Diferuloyl-4-O...

    3-O-Feruloyl-6′-O-(4-O-β-D-glucopyranosylferuloyl)sucrose is a natural compound that can be isolated from Lilium henryi Baker .

  • cpd.5 of 2234271-86-...

    cpd.5 of 2234271-86-2 is a useful organic compound for research related to life sciences. The catalog number is T9794 and the CAS number is 2234284-82-1.

  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.