Soyasaponin Aa

CAS No. 117230-33-8

Soyasaponin Aa( —— )

Catalog No. M31165 CAS No. 117230-33-8

Soyasaponin Aa and soyasaponin Ab dose-dependently markedly inhibit adipocyte differentiation and expression of various adipogenic marker genes, through the downregulation of the adipogenesis-related transcription factors PPARγ and C/EBPα± in 3T3-L1 adipocytes.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 405 In Stock
10MG 598 In Stock
25MG 937 In Stock
50MG 1256 In Stock
100MG 1693 In Stock
200MG 2288 In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Soyasaponin Aa
  • Note
    Research use only, not for human use.
  • Brief Description
    Soyasaponin Aa and soyasaponin Ab dose-dependently markedly inhibit adipocyte differentiation and expression of various adipogenic marker genes, through the downregulation of the adipogenesis-related transcription factors PPARγ and C/EBPα± in 3T3-L1 adipocytes.
  • Description
    Soyasaponin Aa and soyasaponin Ab dose-dependently markedly inhibit adipocyte differentiation and expression of various adipogenic marker genes, through the downregulation of the adipogenesis-related transcription factors PPARγ and C/EBPα± in 3T3-L1 adipocytes.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    117230-33-8
  • Formula Weight
    1365.46
  • Molecular Formula
    C64H100O31
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    ——
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • Gizzerosine HCl

    Gizzerosine 2HCl a substance produced during the heat treatment of fishmeal, induces histopathological lesions in broiler chicks and increases intracellular cyclic adenosine-3',5'-monophosphate levels in isolated chickens of origin.

  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

  • Syringaresinol

    Syringaresinol is a lignan extracted from the sap of Lobelia longifolia with anti-inflammatory activity. syringaresinol causes vasodilation and enhances NO production through phosphorylation and dimerization of endothelial NO synthase.