Isomartynoside

CAS No. 94410-22-7

Isomartynoside( —— )

Catalog No. M31094 CAS No. 94410-22-7

Isomartynoside has inhibition against the angiotensin converting enzyme (ACE) activities, the IC 50 value is 505±26.7μg/ml, it may have antihypertensive effect. Isomartynoside also shows obvious anti-fatigue activity.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 495 In Stock
50MG Get Quote In Stock
100MG Get Quote In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Isomartynoside
  • Note
    Research use only, not for human use.
  • Brief Description
    Isomartynoside has inhibition against the angiotensin converting enzyme (ACE) activities, the IC 50 value is 505±26.7μg/ml, it may have antihypertensive effect. Isomartynoside also shows obvious anti-fatigue activity.
  • Description
    Isomartynoside has inhibition against the angiotensin converting enzyme (ACE) activities, the IC 50 value is 505±26.7μg/ml, it may have antihypertensive effect. Isomartynoside also shows obvious anti-fatigue activity.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    94410-22-7
  • Formula Weight
    652.7
  • Molecular Formula
    C31H40O15
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    ——
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • [D-Pro2,D-Phe7,D-Trp...

    [D-Pro2,D-Phe7,D-Trp9] Substance P is a Substance P analogue. [D-Pro2,D-Phe7,D-Trp9] Substance P is an inhibitor of Substance P. [D-Pro2,D-Phe7,D-Trp9] Substance P contracts guinea-pig ileum (GPI) indirectly.

  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

  • Sulbutiamine

    Sulbutiamine is an antioxidant that act by inhibiting oxidative stress induced retinal ganglion cell death.