Cart
sales@molnova.com
Home - Products - Others - Other Targets - 4-Chlorocinnamic acid

4-Chlorocinnamic acid

CAS No. 1615-02-7

4-Chlorocinnamic acid( —— )

Catalog No. M30918 CAS No. 1615-02-7

4-Chlorocinnamic acid is a photosensitive compound. 2-Chlorocinnamic acid and 4-chlorocinnamic acid show potent urease inhibitory activities with the respective IC50 values of 0.66 and 1.10 uM.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
50MG Get Quote In Stock
100MG Get Quote In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G Get Quote In Stock
Get Quotation Bulk Inquiry Add to Cart

Biological Information

  • Product Name
    4-Chlorocinnamic acid
  • Note
    Research use only, not for human use.
  • Brief Description
    4-Chlorocinnamic acid is a photosensitive compound. 2-Chlorocinnamic acid and 4-chlorocinnamic acid show potent urease inhibitory activities with the respective IC50 values of 0.66 and 1.10 uM.
  • Description
    4-Chlorocinnamic acid is a photosensitive compound. 2-Chlorocinnamic acid and 4-chlorocinnamic acid show potent urease inhibitory activities with the respective IC50 values of 0.66 and 1.10 uM.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    1615-02-7
  • Formula Weight
    182.6
  • Molecular Formula
    C9H7ClO2
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    ——
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

Calculator

Molecular Weight Calculator

Dilution Calculator

Molarity Calculator

molnova catalog
related products

  • 1-Palmitoyl-2-Arachi...

    1-Palmitoyl-2-Arachidonoyl-sn-glycero-3-PC (1-Palmitoyl-2-Arachidonoyl-sn-glycero-3-Phosphocholine) is a phospholipid found in biological membranes that contains palmitic acid (16:0) and arachidonic acid (20:0) in its structure. (16:0) and arachidonic acid (20:4) in its structure.

  • Cremophor EL

    Cremophor EL is a nonionic surfactant. cremophor EL inhibits cellular metabolism and suppresses UGT1A1-mediated rhodopsin glucuronidation.

  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

Sign In Join Free