Luciferase

CAS No. 9014-00-0

Luciferase( —— )

Catalog No. M30043 CAS No. 9014-00-0

Luciferase is a generic term for the class of oxidative enzymes that produce bioluminescence, and is usually distinguished from a photoprotein.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 140 In Stock
10MG 222 In Stock
100MG Get Quote In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock

Biological Information

  • Product Name
    Luciferase
  • Note
    Research use only, not for human use.
  • Brief Description
    Luciferase is a generic term for the class of oxidative enzymes that produce bioluminescence, and is usually distinguished from a photoprotein.
  • Description
    Luciferase is a generic term for the class of oxidative enzymes that produce bioluminescence, and is usually distinguished from a photoprotein.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    9014-00-0
  • Formula Weight
    ——
  • Molecular Formula
    ——
  • Purity
    >98% (HPLC)
  • Solubility
    In Vitro:?H2O : 50 mg/mL
  • SMILES
    ——
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • Maleic acid disodium...

    Maleic acid disodium salt is a pharmaceutical intermediate used in the synthesis of other active compounds.

  • γ-TAC4 (30 - 61) - N...

    γ-TAC4 (30 - 61) - NH2