1-phenylprop-2-en-1-ol

CAS No. 4393-06-0

1-phenylprop-2-en-1-ol( 3-Phenylpropene-3-ol )

Catalog No. M28378 CAS No. 4393-06-0

1-phenylprop-2-en-1-ol is a compound used as a molecular building block.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 45 In Stock
10MG 68 In Stock
25MG 115 In Stock
50MG 173 In Stock
100MG 258 In Stock
200MG 388 In Stock
500MG 642 In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    1-phenylprop-2-en-1-ol
  • Note
    Research use only, not for human use.
  • Brief Description
    1-phenylprop-2-en-1-ol is a compound used as a molecular building block.
  • Description
    1-phenylprop-2-en-1-ol is a compound used as a molecular building block.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    3-Phenylpropene-3-ol
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    BD1-BRD4
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    4393-06-0
  • Formula Weight
    134.178
  • Molecular Formula
    C9H10O
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    OC(C=C)c1ccccc1
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1.Ren C, et al. Spatially constrained tandem bromodomain inhibition bolsters sustained repression of BRD4 transcriptional activity for TNBC cell growth.Proc Natl Acad Sci U S A. 2018 Jul 31;115(31):7949-7954.
molnova catalog
related products
  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • KF38789

    KF 38789 is a selective inhibitor of P-selectin-mediated cell adhesion and P-selectin immunoglobulin G chimeric protein.

  • Mal-PEG2-C2-Boc

    Mal-PEG2-C2-Boc is a PEG-based PROTAC linker that can be used in the synthesis of PROTACs.