Ricinine

CAS No. 524-40-3

Ricinine( Ricinin | Ritsinin | 1,2-Dihydro-4-methoxy-1-methyl-2-oxonicotinonitrile )

Catalog No. M27792 CAS No. 524-40-3

Ricinine is a major alkaloid in Ricinus communis plant with hepatoprotection in CCl4 -induced liver damage.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
1 mL x 10 mM in DMSO 42 In Stock
2MG 29 In Stock
5MG 49 In Stock
10MG 70 In Stock
25MG 116 In Stock
50MG 183 In Stock
100MG 254 In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Ricinine
  • Note
    Research use only, not for human use.
  • Brief Description
    Ricinine is a major alkaloid in Ricinus communis plant with hepatoprotection in CCl4 -induced liver damage.
  • Description
    Ricinine is a major alkaloid in Ricinus communis plant with hepatoprotection in CCl4 -induced liver damage.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    Ricinin | Ritsinin | 1,2-Dihydro-4-methoxy-1-methyl-2-oxonicotinonitrile
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    P. falciparum
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    524-40-3
  • Formula Weight
    164.164
  • Molecular Formula
    C8H8N2O2
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    COc1ccn(C)c(=O)c1C#N
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1.Singh AP, et al. Lipophilic bisphosphonates are potent inhibitors of Plasmodium liver-stage growth. Antimicrob Agents Chemother. 2010 Jul;54(7):2987-93.
molnova catalog
related products
  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

  • Biotin-Substance P

    Biotin-Substance P is the biotin tagged Substance P. Substance P (Neurokinin P) is a neuropeptide, acting as a neurotransmitter and as a neuromodulator in the CNS. The endogenous receptor for substance P is neurokinin 1 receptor (NK1-receptor, NK1R).

  • H-Arg-Arg-Leu-Ile-Gl...

    pp60v-src Autophosphorylation site is a synthetic peptide. pp60v-src Autophosphorylation site can be used for various biochemical studies.