Allopurinol riboside

CAS No. 16220-07-8

Allopurinol riboside( —— )

Catalog No. M26546 CAS No. 16220-07-8

Allopurinol riboside is a metabolite of allopurinol with potency against parasites.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
1 mL x 10 mM in DMSO 84 In Stock
5MG 65 In Stock
10MG 93 In Stock
25MG 154 In Stock
50MG 221 In Stock
100MG 332 In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Allopurinol riboside
  • Note
    Research use only, not for human use.
  • Brief Description
    Allopurinol riboside is a metabolite of allopurinol with potency against parasites.
  • Description
    Allopurinol riboside is a metabolite of allopurinol with potency against parasites. Allopurinol riboside competitively inhibits the action of purine nucleoside phosphorylase on inosine with a Ki of 277 μM.(In Vitro):Allopurinol riboside is effective against parasites including leishmaniasis and American trypanosomiasis. Allopurinol riboside is selectively toxic because it is not metabolized by the corresponding enzymes in humans. Humoral immunity is not suppressed by Allopurinol riboside. Lymphocyte blastogenesis induced by PHA and Con A is significantly suppressed by Allopurinol riboside in a concentration-dependent manner.(In Vivo):Low levels of Allopurinol riboside in plasma are attributable to incomplete absorption and rapid renal clearance. Probenecid reduces the renal clearance of allopurinol riboside, extends the half-life of allopurinol riboside in plasma, and triples the levels of allopurinol riboside in plasma. Allopurinol riboside peaks in plasma 1.6 hours after administration, has an elimination half-life of 3 h, and has steady-state concentrations in the therapeutic range.
  • In Vitro
    Allopurinol-riboside competitively inhibits the action of purine nucleoside phosphorylase on inosine with a Ki of 277 μM. Lymphocyte blastogensis induced by PHA and Con A is significantly suppressed by allopurinol-riboside in a concentration-dependent manner. When LPS is used as a mitogen, the inhibition of allopurinol-ribosideon lymphocyte proliferation is less marked. Humoral immunity is not suppressed by allopurinol-riboside. Allopurinol riboside is an experimental agent for the treatment of leishmaniasis and American trypanosomiasis. Allopurinol riboside is effective against parasites, because a series of enzymes (analogous to those that mediate purine salvage in humans) convert it into 4-aminopyrazolopyrimidine ribonucleoside triphosphate, a cytotoxic product. Allopurinol riboside is selectively toxic, because it is not metabolized by the corresponding enzymes in humans.
  • In Vivo
    Allopurinol riboside peaks in plasma 1.6 hours after administration, has an elimination half-life of 3 hours, and steady-state concentrations in the therapeutic range. After oral administration, unexpectedly low levels of allopurinol riboside in plasma are attributable to incomplete absorption and rapid renal clearance. Probenecid reduces the renal clearance of allopurinol riboside, extends the half-life of allopurinol riboside in plasma, and triples the levels of allopurinol riboside in plasma.
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    16220-07-8
  • Formula Weight
    268.229
  • Molecular Formula
    C10H12N4O5
  • Purity
    >98% (HPLC)
  • Solubility
    In Vitro:?DMSO : 100 mg/mL (372.81 mM)
  • SMILES
    OC[C@H]1O[C@H]([C@H](O)[C@@H]1O)n1ncc2c1[nH]cnc2=O
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1.Novel nutrients to enhance load-induced muscle hypertrophy. WO2021072450A2
molnova catalog
related products
  • Acetovanillone

    Apocynin is a specific NADPH-oxidase inhibitor (IC50: 10 μM).

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • Diastase

    A diastase is any one of a group of enzymes which catalyses the breakdown of starch into maltose.