Home - Products - Others - Other Targets - Procyanidin B2 3,3-di-O-gallate

Procyanidin B2 3,3-di-O-gallate

CAS No. 79907-44-1

Procyanidin B2 3,3-di-O-gallate( —— )

Catalog No. M25040 CAS No. 79907-44-1

Procyanidin B2 3,3-di-O-gallate

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 1798 In Stock
100MG Get Quote In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Procyanidin B2 3,3-di-O-gallate
  • Note
    Research use only, not for human use.
  • Brief Description
    Procyanidin B2 3,3-di-O-gallate
  • Description
    Procyanidin B2 3,3-di-O-gallate
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    79907-44-1
  • Formula Weight
    882.73
  • Molecular Formula
    C44H34O20
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    ——
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • Tepilamide fumarate

    A small-molecule, fumaric acid ester (FAE) compound that is a prodrug of methyl hydrogen fumarate (also known as monomethyl fumarate).

  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

  • δ-Valerolactone

    δ-Valerolactone is a compound commonly used to synthesize copolyesters by means of lipase-catalyzed ring-opening polymerization.