Diethylamine hydrochloride

CAS No. 660-68-4

Diethylamine hydrochloride( METHYLTHIONINIUM CHLORIDE )

Catalog No. M24671 CAS No. 660-68-4

Diethylamine hydrochloride is used for organic synthesis.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
1 mL x 10 mM in DMSO 28 In Stock
25MG 44 In Stock
50MG 63 In Stock
100MG 96 In Stock
200MG Get Quote In Stock
500MG 244 In Stock
1G 359 In Stock

Biological Information

  • Product Name
    Diethylamine hydrochloride
  • Note
    Research use only, not for human use.
  • Brief Description
    Diethylamine hydrochloride is used for organic synthesis.
  • Description
    Diethylamine hydrochloride is used for organic synthesis.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    METHYLTHIONINIUM CHLORIDE
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Others
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    660-68-4
  • Formula Weight
    109.6
  • Molecular Formula
    C4H12ClN
  • Purity
    >98% (HPLC)
  • Solubility
    DMSO:10 mM
  • SMILES
    CCNCC.Cl
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • Zuclopenthixol

    Zuclopenthixol is a thioxanthene with therapeutic actions similar to the phenothiazine antipsychotics. It is an antagonist at D1 and D2 dopamine receptors.

  • ACTH 1-14

    ACTH (1-14) is a fragment of adrenocorticotrophin, which regulates cortisol and androgen production.Adrenocorticotropic hormone (ACTH), also known as corticotropin, is produced and secreted by the anterior pituitary gland. ACTH is an important component of the hypothalamic-pituitary-adrenal axis as a response to biological stress.

  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.