IR-780 Iodide

CAS No. 207399-07-3

IR-780 Iodide( IR 780 iodide | IR780 iodide | IR-780 iodide )

Catalog No. M23931 CAS No. 207399-07-3

IR-780 Iodide, a near‐infrared fluorescent dye, is used for the exclusive characterization of human CSCs through the HIF‐1α/glycolysis dependent mitochondrial transporter ABCB10's activity.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 45 In Stock
10MG 68 In Stock
25MG 115 In Stock
50MG 173 In Stock
100MG 258 In Stock
200MG 388 In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    IR-780 Iodide
  • Note
    Research use only, not for human use.
  • Brief Description
    IR-780 Iodide, a near‐infrared fluorescent dye, is used for the exclusive characterization of human CSCs through the HIF‐1α/glycolysis dependent mitochondrial transporter ABCB10's activity.
  • Description
    IR-780 Iodide, a near‐infrared fluorescent dye, is used for the exclusive characterization of human CSCs through the HIF‐1α/glycolysis dependent mitochondrial transporter ABCB10's activity.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    IR 780 iodide | IR780 iodide | IR-780 iodide
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Others
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    207399-07-3
  • Formula Weight
    667.12
  • Molecular Formula
    C36H44ClIN2
  • Purity
    >98% (HPLC)
  • Solubility
    Methanol:Soluble
  • SMILES
    CC1(C)C(/C=C/C2=C(Cl)/C(CCC2)=C/C=C3N(CCC)C4=C(C=CC=C4)C\3(C)C)=[N+](CCC)C5=C1C=CC=C5.[I-]
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1.Li S, Zhou S, Li Y, Li X, Zhu J, Fan L, Yang S. Exceptionally High Payload of the IR780 Iodide on Folic Acid-Functionalized Graphene Quantum Dots for Targeted Photothermal Therapy. ACS Appl Mater Interfaces. 2017 Jul 12;9(27):22332-22341. doi: 10.1021/acsami.7b07267. Epub 2017 Jun 28. PubMed PMID: 28643511.
molnova catalog
related products
  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

  • Suc-Leu-Leu-Val-Tyr-...

    Suc-Leu-Leu-Val-Tyr-AMC is a fluorescent substrate for the 20S proteasome, other chymotrypsin-like proteases.

  • Clindamycin palmitat...

    Clindamycin palmitate HCl is a water soluble hydrochloride salt of the ester of clindamycin and palmitic acid and a lincosamide antibiotic.