Alendronic Acid

CAS No. 66376-36-1

Alendronic Acid( alendronate )

Catalog No. M20828 CAS No. 66376-36-1

Alendronic acid is a nonhormonal medication used for osteoporosis osteogenesis imperfecta and several other bone diseases.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
50MG 39 In Stock
100MG 61 In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Alendronic Acid
  • Note
    Research use only, not for human use.
  • Brief Description
    Alendronic acid is a nonhormonal medication used for osteoporosis osteogenesis imperfecta and several other bone diseases.
  • Description
    Alendronic acid is a nonhormonal medication used for osteoporosis osteogenesis imperfecta and several other bone diseases.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    alendronate
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Others
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    66376-36-1
  • Formula Weight
    249.1
  • Molecular Formula
    C4H13NO7P2
  • Purity
    >98% (HPLC)
  • Solubility
    In Vitro:?H2O : 3.7 mg/mL (14.85 mM)
  • SMILES
    NCCCC(O)(P(=O)(O)O)P(=O)(O)O
  • Chemical Name
    (4-Amino-1-hydroxybutylidene)diphosphonic acid

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1.Martín Siguero A áreas Del águila VL Franco Sereno M T et al. Efficacy and safety of alendronic acid in the treatment of osteoporosis in children.[J]. Farm Hosp 2015 39(6):350-354.
molnova catalog
related products
  • Rimantadine hydrochl...

    Rimantadine Hcl (Flumadine) is an anti-influenza virus drug.

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • Allocholic acid

    Allocholic acid is a major component in bile from the river carpsucker, Carpiodes carpio.