Home - Products - Others - Other Targets - 4-Bromomethyl-2-cyanobiphenyl

4-Bromomethyl-2-cyanobiphenyl

CAS No. 114772-54-2

4-Bromomethyl-2-cyanobiphenyl( —— )

Catalog No. M19899 CAS No. 114772-54-2

4’-Bromomethyl-2-cyanobiphenyl is a halogenated benzonitrile used in protein-binding studies of quinoxaline angiotensin II receptor antagonists.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
1 mL x 10 mM in DMSO 28 In Stock
10MG 29 In Stock
25MG 46 In Stock
50MG 65 In Stock
100MG 96 In Stock
200MG Get Quote In Stock
500MG 216 In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    4-Bromomethyl-2-cyanobiphenyl
  • Note
    Research use only, not for human use.
  • Brief Description
    4’-Bromomethyl-2-cyanobiphenyl is a halogenated benzonitrile used in protein-binding studies of quinoxaline angiotensin II receptor antagonists.
  • Description
    4’-Bromomethyl-2-cyanobiphenyl is a halogenated benzonitrile used in protein-binding studies of quinoxaline angiotensin II receptor antagonists.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Others
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    114772-54-2
  • Formula Weight
    272.14
  • Molecular Formula
    C14H10BrN
  • Purity
    >98% (HPLC)
  • Solubility
    DMSO:10 mM
  • SMILES
    BrCc1ccc(cc1)-c1ccccc1C#N
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • 4-Isopropylphenol

    4-Isopropylphenol is corrosive to the skin and cornea.

  • LMP2 (236 - 244) , R...

    LMP2 (236 - 244) , RRR

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.