Olivetol

CAS No. 500-66-3

Olivetol( —— )

Catalog No. M18664 CAS No. 500-66-3

Olivetol (5-pentylresorcinol, 5-pentyl-1,3-benzenediol) is an organic compound found in certain species of lichen; it is also a precursor in various syntheses of tetrahydrocannabinol. Olivetol has an antioxidant effect.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
1 mL x 10 mM in DMSO 29 In Stock
100MG Get Quote In Stock
200MG Get Quote In Stock
500MG 46 In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Olivetol
  • Note
    Research use only, not for human use.
  • Brief Description
    Olivetol (5-pentylresorcinol, 5-pentyl-1,3-benzenediol) is an organic compound found in certain species of lichen; it is also a precursor in various syntheses of tetrahydrocannabinol. Olivetol has an antioxidant effect.
  • Description
    Olivetol (5-pentylresorcinol, 5-pentyl-1,3-benzenediol) is an organic compound found in certain species of lichen; it is also a precursor in various syntheses of tetrahydrocannabinol. Olivetol has an antioxidant effect.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    IκB
  • Research Area
    Others-Field
  • Indication
    ——

Chemical Information

  • CAS Number
    500-66-3
  • Formula Weight
    180.24
  • Molecular Formula
    C11H16O2
  • Purity
    >98% (HPLC)
  • Solubility
    In Vitro:?DMSO : 100 mg/mL (554.82 mM)
  • SMILES
    CCCCCc1cc(cc(c1)O)O
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1.Sarah K. Oettl, et al. PLoS One. 2013; 8(10): e76929.
molnova catalog
related products
  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • 4-Hydroxy-3-methoxyb...

    Vanillylamine is an alkaloid that is an intermediate in the biosynthesis of capsaicin. Vanillylamine is produced from vanillin by the enzyme vanillin aminotransferase.

  • DMPS

    Sodium 2,3-dimercaptopropanesulfonate monohydrate