STF-083010

CAS No. 307543-71-1

STF-083010( STF-083010 | STF 083010 | STF083010, IRE1 Inhibitor I )

Catalog No. M18401 CAS No. 307543-71-1

STF-083010 is a selective inhibitor of the IRE1α endonuclease.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
1 mL x 10 mM in DMSO 50 In Stock
5MG 45 In Stock
10MG 69 In Stock
25MG 117 In Stock
50MG 200 In Stock
100MG 360 In Stock
200MG 544 In Stock
500MG 793 In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    STF-083010
  • Note
    Research use only, not for human use.
  • Brief Description
    STF-083010 is a selective inhibitor of the IRE1α endonuclease.
  • Description
    STF-083010, also known as IRE1 Inhibitor I, is an inhibitor of the IRE1/XBP1 pathway.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    STF-083010 | STF 083010 | STF083010, IRE1 Inhibitor I
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    IRE1α
  • Research Area
    Cancer
  • Indication
    ——

Chemical Information

  • CAS Number
    307543-71-1
  • Formula Weight
    317.38
  • Molecular Formula
    C15H11NO3S2
  • Purity
    >98% (HPLC)
  • Solubility
    DMSO : 100 mg/mL 315.08 mM; H2O : < 0.1 mg/mL
  • SMILES
    c1ccc2c(c1)C=CC(=O)/C/2=C\NS(=O)(=O)c1cccs1
  • Chemical Name
    (E)-N-((2-hydroxynaphthalen-1-yl)methylene)thiophene-2-sulfonamide

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1. Papandreou l, et al. Blood. 2011, 117(4), 1311-1314.
molnova catalog
related products
  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • AZD1208

    AZD1208 is a novel, orally bioavailable, highly selective PIM kinase inhibitor with single nanomolar potency against all three PIM kinases.

  • Nandrolone acetate

    Nandrolone acetate is a competitive inhibitor of isomerase with the Ki of 7 μM for Δ5-3-ketosteroid isomerase of Pseudomonas testosreroni.