Laurolitsine

CAS No. 5890-18-6

Laurolitsine ( (+)-Norboldine )

Catalog No. M24581 CAS No. 5890-18-6

Laurolitsine is an alkaloid isolated from the leaves of Peumus boldus Molina.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 135 In Stock
10MG 196 In Stock
25MG 332 In Stock
50MG 493 In Stock
100MG 709 In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Laurolitsine
  • Note
    Research use only, not for human use.
  • Brief Description
    Laurolitsine is an alkaloid isolated from the leaves of Peumus boldus Molina.
  • Description
    Laurolitsine is an alkaloid isolated from the leaves of Peumus boldus Molina.
  • Synonyms
    (+)-Norboldine
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Others
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    5890-18-6
  • Formula Weight
    313.3
  • Molecular Formula
    C18H19NO4
  • Purity
    >98% (HPLC)
  • Solubility
    DMSO:10 mM
  • SMILES
    OC1=C(OC)C2=C3C(CCN[C@@]3([H])CC4=CC(O)=C(OC)C=C24)=C1
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1.Teng CM, et al. Antiplatelet effects of some aporphine and phenanthrene alkaloids in rabbits and man. J Pharm Pharmacol. 1997 Jul;49(7):706-11.
molnova catalog
related products
  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • [Pro3]-GIP (Rat)

    High affinity rat GIP receptor partial agonist (Kd = 13 nM). Increases cAMP accumulation in COS-7 cells transfected with rat GIP receptor, while also acting as a competitive antagonist of GIP.

  • MAC-545496

    MAC-545496 is a glycopeptide-resistance-associated protein R (GraR) inhibitor, is an antivirulence agent.