L-Sophoridine

CAS No. 83148-91-8

L-Sophoridine ( —— )

Catalog No. M19154 CAS No. 83148-91-8

Sophoridine, a natural product obtained from medicinal plants, which has a variety of pharmacological effects.

Purity : 98%

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 45 In Stock
10MG 68 In Stock
25MG 115 In Stock
50MG 173 In Stock
100MG 258 In Stock
200MG 388 In Stock
500MG 642 In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    L-Sophoridine
  • Note
    Research use only, not for human use.
  • Brief Description
    Sophoridine, a natural product obtained from medicinal plants, which has a variety of pharmacological effects.
  • Description
    Sophoridine, a natural product obtained from medicinal plants, which has a variety of pharmacological effects, including anti-Y effects, and selectively induces apoptotic cell death in a variety of human Y cells in vitro and in vivo; however, its mechanism of action needs to be further elaborated.
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Others
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    83148-91-8
  • Formula Weight
    248.36
  • Molecular Formula
    C15H24N2O
  • Purity
    98%
  • Solubility
    ——
  • SMILES
    N12CCC[C@@H]3[C@@H]4N(C[C@H]([C@H]13)CCC2)C(=O)CCC4
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • 3-O-Galloylmyricitri...

    3''-O-Galloylmyricitrin is a natural product.

  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

  • Ceftizoxime

    Ceftizoxime is a cephalosporin-based, potent antibacterial agent which can be administered intravenously or by suppository.