DMT1 blocker 2

CAS No. 1062648-63-8

DMT1 blocker 2( —— )

Catalog No. M23267 CAS No. 1062648-63-8

DMT1 blocker 2, compound 12f, is a direct inhibitor of divalent metal transporter 1 (DMT1) with an IC50 hydrogen peroxide value of 0.83.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 178 In Stock
10MG 335 In Stock
25MG 566 In Stock
50MG 806 In Stock
100MG 1098 In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    DMT1 blocker 2
  • Note
    Research use only, not for human use.
  • Brief Description
    DMT1 blocker 2, compound 12f, is a direct inhibitor of divalent metal transporter 1 (DMT1) with an IC50 hydrogen peroxide value of 0.83.
  • Description
    DMT1 blocker 2, compound 12f, is a direct inhibitor of divalent metal transporter 1 (DMT1) with an IC50 hydrogen peroxide value of 0.83, which is expected to block iron uptake by intestinal epithelial cells in vivo.
  • In Vitro
    ——
  • In Vivo
    Animal Model:Weanling (3-4 weeks) rats were placed on a low iron diet for four weeks Dosage:50 mg/kg Administration:Oral gavage followed 1 h later by an iron challenge Result:Attenuated the post-challenge serum iron increase.
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    DMT1
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    1062648-63-8
  • Formula Weight
    263.29
  • Molecular Formula
    C16H13N3O
  • Purity
    >98% (HPLC)
  • Solubility
    DMSO:48 mg/mL?(182.3 mM;?Need ultrasonic)
  • SMILES
    OC1=C2C3=CC=CC=C3CCC2=NN1C4=NC=CC=C4
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1.Cadieux JA, et al. Synthesis and biological evaluation of substituted pyrazoles as blockers of divalent metal transporter 1 (DMT1). Bioorg Med Chem Lett. 2012 Jan 1;22(1):90-5.
molnova catalog
related products
  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • Dansylamide

    Dansyl amide is a fluorescent dye used in biochemistry and chemistry to label substances with the fluorescent dansyl group.

  • N4-Acetylcytidine

    N4-Acetylcytidine is a modified nucleoside. N4-acetylcytidine is an endogenous urinary nucleoside product of the degradation of transfer ribonucleic acid (tRNA).