DMT1 blocker 2
CAS No. 1062648-63-8
DMT1 blocker 2( —— )
Catalog No. M23267 CAS No. 1062648-63-8
DMT1 blocker 2, compound 12f, is a direct inhibitor of divalent metal transporter 1 (DMT1) with an IC50 hydrogen peroxide value of 0.83.
Purity : >98% (HPLC)
COA
Datasheet
HNMR
HPLC
MSDS
Handing Instructions
| Size | Price / USD | Stock | Quantity |
| 5MG | 178 | In Stock |
|
| 10MG | 335 | In Stock |
|
| 25MG | 566 | In Stock |
|
| 50MG | 806 | In Stock |
|
| 100MG | 1098 | In Stock |
|
| 200MG | Get Quote | In Stock |
|
| 500MG | Get Quote | In Stock |
|
| 1G | Get Quote | In Stock |
|
Biological Information
-
Product NameDMT1 blocker 2
-
NoteResearch use only, not for human use.
-
Brief DescriptionDMT1 blocker 2, compound 12f, is a direct inhibitor of divalent metal transporter 1 (DMT1) with an IC50 hydrogen peroxide value of 0.83.
-
DescriptionDMT1 blocker 2, compound 12f, is a direct inhibitor of divalent metal transporter 1 (DMT1) with an IC50 hydrogen peroxide value of 0.83, which is expected to block iron uptake by intestinal epithelial cells in vivo.
-
In Vitro——
-
In VivoAnimal Model:Weanling (3-4 weeks) rats were placed on a low iron diet for four weeks Dosage:50 mg/kg Administration:Oral gavage followed 1 h later by an iron challenge Result:Attenuated the post-challenge serum iron increase.
-
Synonyms——
-
PathwayOthers
-
TargetOther Targets
-
RecptorDMT1
-
Research Area——
-
Indication——
Chemical Information
-
CAS Number1062648-63-8
-
Formula Weight263.29
-
Molecular FormulaC16H13N3O
-
Purity>98% (HPLC)
-
SolubilityDMSO:48 mg/mL?(182.3 mM;?Need ultrasonic)
-
SMILESOC1=C2C3=CC=CC=C3CCC2=NN1C4=NC=CC=C4
-
Chemical Name——
Shipping & Storage Information
-
Storage(-20℃)
-
ShippingWith Ice Pack
-
Stability≥ 2 years
Reference
1.Cadieux JA, et al. Synthesis and biological evaluation of substituted pyrazoles as blockers of divalent metal transporter 1 (DMT1). Bioorg Med Chem Lett. 2012 Jan 1;22(1):90-5.
molnova catalog
related products
-
Exendin-4 peptide de...
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.
-
Dansylamide
Dansyl amide is a fluorescent dye used in biochemistry and chemistry to label substances with the fluorescent dansyl group.
-
N4-Acetylcytidine
N4-Acetylcytidine is a modified nucleoside. N4-acetylcytidine is an endogenous urinary nucleoside product of the degradation of transfer ribonucleic acid (tRNA).
Cart
sales@molnova.com