14-Dichlorobenzene

CAS No. 106-46-7

14-Dichlorobenzene ( p-Dichlorobenzene; para-dichlorobenzene )

Catalog No. M20886 CAS No. 106-46-7

14-Dichlorobenzene is a disinfectant pesticide and deodorant.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
500MG 26 In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    14-Dichlorobenzene
  • Note
    Research use only not for human use.
  • Brief Description
    14-Dichlorobenzene is a disinfectant pesticide and deodorant.
  • Description
    14-Dichlorobenzene is a disinfectant pesticide and deodorant.
  • Synonyms
    p-Dichlorobenzene; para-dichlorobenzene
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Others
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    106-46-7
  • Formula Weight
    147
  • Molecular Formula
    C6H4Cl2
  • Purity
    >98% (HPLC)
  • Solubility
    DMSO:29 mg/mL (197.27 mM)
  • SMILES
    Clc1ccc(Cl)cc1
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1.Pei G Sun C Zhu Y et al. Biosurfactant-enhanced removal of op-dichlorobenzene from contaminated soil[J]. Environmental Science and Pollution Research 2016 25(1):1-9.
molnova catalog
related products
  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • 4,6-Dibromoindole

    4,6-Dibromoindole is a marine derived natural products found in Glossobalanus sp.

  • DL-Threitol

    D-threitol is the D-enantiomer of threitol. It has a role as a human metabolite. It is an enantiomer of a?L-threitol.