PA (224–233), Influenza

CAS No. ———

PA (224–233), Influenza( ——— )

Catalog No. M41307 CAS No. ———

PA (224–233), Influenza

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
25MG Get Quote Get Quote
50MG Get Quote Get Quote
100MG Get Quote Get Quote
200MG Get Quote Get Quote
500MG Get Quote Get Quote
1G Get Quote Get Quote

Biological Information

  • Product Name
    PA (224–233), Influenza
  • Note
    Research use only, not for human use.
  • Brief Description
    PA (224–233), Influenza
  • Description
    PA (224–233), Influenza
  • In Vitro
    ———
  • In Vivo
    ———
  • Synonyms
    ———
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ———
  • Research Area
    ———
  • Indication
    ———

Chemical Information

  • CAS Number
    ———
  • Formula Weight
    1185.31
  • Molecular Formula
    C53H80N14O17
  • Purity
    >98% (HPLC)
  • Solubility
    ———
  • SMILES
    ———
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • 2-(Chloromethyl)Imid...

    2-(Chloromethyl)imidazo[1,2-a]pyridine has potential anthelmintic activity and can be used to synthesize active compounds.

  • Borapetoside B

    Borapetoside B is a natural product of Tinospora, Menispermaceae. Borapetoside B can be used as a reference standard.