Tetanus toxin 830-843

CAS No. 119260-99-0

Tetanus toxin 830-843( —— )

Catalog No. M30287 CAS No. 119260-99-0

Tetanus toxin (830-843) from tetanus toxoid is a universal human tetanus toxin T cell epitope. It induces T-cell activation and is used as a helper peptide in vaccinations.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
100MG Get Quote Get Quote
200MG Get Quote Get Quote
500MG Get Quote Get Quote
1G Get Quote Get Quote

Biological Information

  • Product Name
    Tetanus toxin 830-843
  • Note
    Research use only, not for human use.
  • Brief Description
    Tetanus toxin (830-843) from tetanus toxoid is a universal human tetanus toxin T cell epitope. It induces T-cell activation and is used as a helper peptide in vaccinations.
  • Description
    Tetanus toxin (830-843) from tetanus toxoid is a universal human tetanus toxin T cell epitope. It induces T-cell activation and is used as a helper peptide in vaccinations.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    119260-99-0
  • Formula Weight
    1611.84
  • Molecular Formula
    C74H118N18O22
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    ——
  • Chemical Name
    Sequence:{Gln}{Tyr}{Ile}{Lys}{Ala}{Asn}{Ser}{Lys}{Phe}{Ile}{Gly}{Ile}{Thr}{Glu}

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

Diethelm-Okita BM, et al. Epitope repertoire of human CD4+ T cells on tetanus toxin: identification of immunodominant sequence segments. J Infect Dis. 1997 Feb;175(2):382-91.
molnova catalog
related products
  • Amino-PEG7-acid

    Amino-PEG7-acid is a PEG-based PROTAC linker that can be used in the synthesis of PROTACs.

  • HIV -gp120- Fragment...

    HIV gp120 421-438 is HIV antigen fragments, that conjugates with keyhole limpet hemocyanin (KLH) and generates specific anti-HIV antibody.

  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.